Skip to product information

🧬 LL-37 10MG

$179.99
 per 
  • Sku: LL37-10MG
  • Barcode:
  • Vendor: Accelerate Labs
  • Type: Research Peptides

Free Shipping: Orders $300+

Same Day Shipping: Paid Before 3PM EST.

Arrives Lyophilized: Requires Reconstitution

Product Description

 

📌 Peptide Details:

  • Sequence: [LL-37, 37 aa]
  • Molecular Formula: C211H370N64O49
  • Molecular Weight: 4493.26 g/mol
  • CAS Number: 143197-61-9
  • PubChem CID: 16132308
  • Synonyms:
    • LL37

    • Cathelicidin

    • Human cationic antimicrobial protein 18 (hCAP18) fragment

    • FALL-39

In Stock - Ready to Ship
Spend $250.00 to FREE SHIPPING

Product Disclaimer

This product arrives as a lyophilized powder. Researchers are responsible for reconstitution of all research products. Bacteriostatic water sold separately. We do not offer syringes for sale or provide instructions on mixing, dosing or protocol.

This product is strictly intended for research use only. Limited to in vitro testing and laboratory experimentation. It is not for human or animal use or consumption of any kind. Handling is restricted to licensed, qualified professionals only. This product is not classified as a drug, food, or cosmetic and must not be misbranded, misused, or mislabeled as such.

3rd Party Testing

At Accelerate Labs, we take the integrity of our research peptides seriously. That’s why every batch undergoes rigorous 3rd party testing in the USA to ensure the highest standards of purity and quality before they are made available for purchase. We've partnered with MZ Biolabs, a trusted, DEA schedule III licensed facility, to handle our Certificates of Analysis (COAs) and verify that each product meets the specifications required for research.

Same Day Shipping

All orders are shipped Monday through Saturday. Orders paid before 3:00 PM Eastern are processed and shipped the same day.

Estimated Transit Times:

  • Standard Shipping (USPS): 3–6 business days
  • Express Shipping (UPS): 2–3 business days

Please note that transit times are estimates and may vary due to factors such as carrier delays, high seasonal demand, inclement weather, holiday closures, or other unforeseen circumstances.

While we do our best to ensure timely delivery, we are not responsible for carrier delays and can only provide tracking information as updated by USPS or UPS.

View full details

🧬 LL-37 10MG

$179.99
 per 

Recently Viewed

Proudly Supporting Scientific Innovation & Research Since 2019.

DISCLAIMER: Not for human consumption of any kind. Intended for research & lab use only. These statements have not been evaluated by the Food and Drug Administration. These products are not intended to diagnose, treat, cure, or prevent any disease.