𧬠GLP-1 (S) 5MG
- Sku: SEMA-5MG
- Barcode:
- Vendor: Accelerate Labs
- Type: Research Peptides
Free Shipping: Orders $300+
Same Day Shipping: Paid Before 3PM EST.
Arrives Lyophilized: Requires Reconstitution
Product Description
Β
π¬ Peptide Details
-
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
-
Molecular Formula: CβββHβββNββ Oβ β
-
Molecular Weight: 4113.58 g/mol
-
CAS Number: 910463-68-2
-
PubChem CID: 56843331
This product arrives as a lyophilized powder. Researchers are responsible for reconstitution of all research products. Bacteriostatic water sold separately. We do not offer syringes for sale or provide instructions on mixing, dosing or protocol.
This product is strictly intended for research use only. Limited to in vitro testing and laboratory experimentation. It is not for human or animal use or consumption of any kind. Handling is restricted to licensed, qualified professionals only. This product is not classified as a drug, food, or cosmetic and must not be misbranded, misused, or mislabeled as such.
At Accelerate Labs, we take the integrity of our research peptides seriously. Thatβs why every batch undergoes rigorous 3rd party testing in the USA to ensure the highest standards of purity and quality before they are made available for purchase. We've partnered with MZ Biolabs, a trusted, DEA schedule III licensed facility, to handle our Certificates of Analysis (COAs) and verify that each product meets the specifications required for research.
All orders are shipped Monday through Saturday. Orders paid before 3:00 PM Eastern are processed and shipped the same day.
Estimated Transit Times:
- Standard Shipping (USPS): 3β6 business days
- Express Shipping (UPS): 2β3 business days
Please note that transit times are estimates and may vary due to factors such as carrier delays, high seasonal demand, inclement weather, holiday closures, or other unforeseen circumstances.
While we do our best to ensure timely delivery, we are not responsible for carrier delays and can only provide tracking information as updated by USPS or UPS.

𧬠GLP-1 (S) 5MG
About Accelerate Labs
Industry Leader & Trusted Source for Research Grade Peptides and Amino Derivatives in the USA.
Proudly Supporting Scientific Innovation & Research Since 2019.
DISCLAIMER: Not for human consumption of any kind. Intended for research & lab use only. These statements have not been evaluated by the Food and Drug Administration. These products are not intended to diagnose, treat, cure, or prevent any disease.





